ALS2CR15 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP19018525UL

Catalog No. NB405593

Description

ALS2CR15 Polyclonal specifically detects ALS2CR15 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ALS2CR15
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q8NDH6
• Gene Symbols: ICA1L
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SPSASLTSQEPSMGSEPLAHSSRFLPSQLFDLGFHVAGAFNNWVSQEESELCLSHTDNQPVPSQSPKKLTRSPNNGNQD
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ALS2CR14, ALS2CR15, amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 14, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 14 protein, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 15 protein, candidate 15, DKFZp434E1919, Ica69-related protein, islet cell autoantigen 1,69kDa-like, islet cell autoantigen 1-like protein, MGC138440
• Host Species: Rabbit
• Molecular Weight of Antigen: 54 kDa
• Quantity: 25 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 130026
• Target Species: Human
• Isotype: IgG

For Research Use Only