Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ALX3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP180285 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP180285 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP180285 Supplier Novus Biologicals Supplier No. NBP180285
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

ALX3 Polyclonal specifically detects ALX3 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen ALX3
Applications Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O70137
Gene Alias ALX homeobox 3, aristaless-like homeobox 3, homeobox protein aristaless-like 3, MGC138212, MGC141988, Proline-rich transcription factor ALX3
Gene Symbols ALX3
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of mouse ALX3 (NP_031467). Peptide sequence MDPERCAPFSVGPAAGPYAAAGDEAPGPQGTPDAAPHLHPAPPRGPRLSR.
Molecular Weight of Antigen 37 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 257
Test Specificity Expected identity based on immunogen sequence: Mouse: 100%; Bovine: 92%; Rat: 92%; Human: 78%.
Reconstitution Centrifuge vial prior to reconstitution. Add 100μL distilled water to a final antibody concentration of 1mg/mL.
Target Species Human, Mouse, Rat, Bovine, Guinea Pig
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.