AMD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18709425UL

Catalog No. NB406229

Description

AMD1 Polyclonal specifically detects AMD1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: AMD1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: adenosylmethionine decarboxylase 1, AdoMetDC, AMD, DKFZp313L1234, EC 4.1.1.50, S-adenosylmethionine decarboxylase 1, S-adenosylmethionine decarboxylase proenzyme, SAMDCFLJ26964
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: AMD1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TIHITPEPEFSYVSFETNLSQTSYDDLIRKVVEVFKPGKFVTTLFVNQSSKCRTVLASPQKIEGFKRLDCQSAMFNDYN
• Quantity: 25 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 262
• Target Species: Human
• Isotype: IgG

For Research Use Only