Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

AMPD2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$254.42 - $727.54

Specifications

Antigen	AMPD2
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP247549 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP247549	0.1 mL	Each for $727.54	Only null left	Sign In or Register to check your price. Add to Cart

NB404498 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP24754925UL	25 μL	Each for $254.42	Only null left	Sign In or Register to check your price. Add to Cart

Description

AMPD2 Polyclonal specifically detects AMPD2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen	AMPD2
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	metabolism
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	271
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: MDGKCKEIAEELFTRSLAESELRSAPYEFPEESPIEQLEERRQRLERQISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGE
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human, Mouse
Gene Alias	adenosine monophosphate deaminase 2, adenosine monophosphate deaminase 2 (isoform L), AMP deaminase 2, AMP deaminase isoform L, AMPD, EC 3.5.4.6
Gene Symbols	AMPD2
Isotype	IgG
Purification Method	Affinity Purified

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

AMPD2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents