Invitrogen™ AMPK beta-1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595312

Catalog No. PIPA595312

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: JURKAT whole cell, PANC whole cell, K562 whole cell. ICC/IF: A431 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

AMPK beta 1 is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. The myristoylation and phosphorylation of this subunit have been shown to affect the enzyme activity and cellular localization of AMPK. This subunit may also serve as an adaptor molecule mediating the association of the AMPK complex.

Specifications

• Antigen: AMPK beta-1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: PRKAB1
• Gene Alias: 1300015D22Rik; 5'-AMP-activated protein kinase 40 kDa subunit; 5-AMP-activated protein kinase beta subunit; 5'-AMP-activated protein kinase beta-1 subunit; 5'-AMP-activated protein kinase subunit beta-1; 5'-AMP-activated protein kinase subunit beta-1-like protein; 5'-AMP-activated protein kinase, beta subunit; AAKB1; AMP-activated protein kinase beta subunit; AMPK; AMPK beta 1; AMPK beta -1 chain; AMPK beta-1 chain; AMPK subunit beta-1; AMPKb; AMPK-beta1; AU021155; E430008F22; HAMPKb; kinase AMPK-beta1; kinase pAMPK; pAMPK; Prkab1; protein kinase AMP-activated non-catalytic subunit beta 1; protein kinase, AMP-activated, beta 1 non-catalytic subunit; protein kinase, AMP-activated, noncatalytic, beta-1
• Host Species: Rabbit
• Purification Method: Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 5564
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: Q9Y478
• Gene Symbols: PRKAB1
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human AMPK beta 1 (32-68aa DRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLE).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov