Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AMPK gamma 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP257986
Description
AMPK gamma 1 Polyclonal specifically detects AMPK gamma 1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
AMPK gamma 1 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
5'-AMP-activated protein kinase subunit gamma-1, 5'-AMP-activated protein kinase, gamma-1 subunit, AMPK gamma1, AMPK gamma-1 chain, AMPK subunit gamma-1, AMPKg, MGC8666, protein kinase, AMP-activated, gamma 1 non-catalytic subunit | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
PRKAG1 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:METVISSDSSPAVENEHPQETPESNNSVYT | |
100 μL | |
Cancer, Hypoxia | |
5571 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction