Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. AMSH-LP Antibody, Novus Biologicals™

AMSH-LP Antibody, Novus Biologicals™
SDP

Catalog No. NB430899 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB430899 25 μL
NBP189135 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB430899 Supplier Novus Biologicals Supplier No. NBP18913525UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

AMSH-LP Polyclonal specifically detects AMSH-LP in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen AMSH-LP
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q96FJ0
Gene Alias ALMalpha, AMSH-FP, AMSHLP, AMSH-LPassociated molecule with the SH3 domain of STAM (AMSH) - Family Protein, associated molecule with the SH3 domain of STAM (AMSH) like protein, bA399O19.2, EC 3.1.2.15, EC 3.4.19.-, FLJ31524, KIAA1373AMSH-like protease, STAM binding protein-like 1, STAM-binding protein-like 1
Gene Symbols STAMBPL1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LKKYNVEYQEYLQSKNKYKAEILKKLEHQRLIEAERKRIAQMRQQQLESEQFLFFEDQLKKQELARGQMRSQQTSGLS
Molecular Weight of Antigen 50 kDa
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline DNA replication Transcription Translation and Splicing
Primary or Secondary Primary
Gene ID (Entrez) 57559
Test Specificity Specificity of human AMSH-LP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.