Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AMSH/STAMBP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP26862725UL
Description
AMSH/STAMBP Polyclonal antibody specifically detects AMSH/STAMBP in Human samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| AMSH/STAMBP | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| AMSHAssociated molecule with the SH3 domain of STAM, EC 3.1.2.15, EC 3.4.19.-, Endosome-associated ubiquitin isopeptidase, MGC126516, MGC126518, STAM binding protein, STAM-binding protein | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCG | |
| 25 μL | |
| Cell Cycle and Replication | |
| 10617 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction