Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ANKFY1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310700100UL
Description
ANKFY1 Polyclonal specifically detects ANKFY1 in Human samples. It is validated for Western Blot.Specifications
ANKFY1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
ANKHZN, ankyrin repeat and FYVE domain containing 1, ankyrin repeat and FYVE domain-containing protein 1, ankyrin repeat hooked to zinc finger motif, ankyrin repeats hooked to a zinc finger motif, DKFZp686M19106, KIAA1255, Rabankyrin-5, ZFYVE14 | |
The immunogen for Anti-ANKFY1 antibody is: synthetic peptide directed towards the N-terminal region of Human ANFY1 (XP_005256736.1). Peptide sequence TPLHLVALYSSKKHSADVMSEMAQIAEALLQAGANPNMQDSKGRTPLHVS | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
51479 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction