ANKH Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159748

Catalog No. NBP159748

Description

ANKH Polyclonal specifically detects ANKH in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ANKH
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ANKcraniometaphyseal dysplasia, Jackson type (dominant), ankylosis, progressive (mouse) homolog, ankylosis, progressive homolog (mouse), CCAL2, CMDJ, CPPDDFLJ27166, HANKMANK, KIAA1581, progressive ankylosis protein homolog
• Host Species: Rabbit
• Molecular Weight of Antigen: 54 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9HCJ1
• Gene Symbols: ANKH
• Immunogen: Synthetic peptides corresponding to ANKH(ankylosis, progressive homolog (mouse)) The peptide sequence was selected from the N terminal of ANKH (NP_473368). Peptide sequence SDLGYYIINKLHHVDESVGSKTRRAFLYLAAFPFMDAMAWTHAGILLKHK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 56172
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only