ANKRD11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP152984

Catalog No. NBP152984

Description

ANKRD11 Polyclonal specifically detects ANKRD11 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ANKRD11
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ANCO-1, ANCO1ankyrin repeat domain-containing protein 11, ankyrin repeat domain 11, Ankyrin repeat-containing cofactor 1, ankyrin repeat-containing protein 11, LZ16, nasopharyngeal carcinoma susceptibility protein, T13
• Host Species: Rabbit
• Molecular Weight of Antigen: 298 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Zebrafish: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 4-8 ug/ml, Immunohistochemistry-Paraffin 4-8 ug/ml
• Gene Accession No.: Q6UB99
• Gene Symbols: ANKRD11
• Immunogen: Synthetic peptides corresponding to ANKRD11 (ankyrin repeat domain 11) The peptide sequence was selected from the N terminal of ANKRD11 (NP_037407). Peptide sequence: KRKLPFTAGANGEQKDSDTEKQGPERKRIKKEPVTRKAGLLFGMGLSGIR.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 29123
• Reconstitution: Centrifuge vial prior to reconstitution. Add 100μL distilled water to a final antibody concentration of 1mg/mL.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only