Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ANKRD13A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP23850525UL
Description
ANKRD13A Polyclonal specifically detects ANKRD13A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
ANKRD13A | |
Polyclonal | |
Western Blot 0.4 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
Q8IZ07 | |
ANKRD13A | |
This antibody was developed against a recombinant protein corresponding to amino acids: IQQSLLESSRSQELSGPASNGGISQTNTYDAQYERAIQESLLTSTEGLCPSALSETSRFDNDLQLAMELSAKELEEWELRLQEE | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
ANKRD13, ankyrin repeat domain 13, ankyrin repeat domain 13A, ankyrin repeat domain-containing protein 13A, NY-REN-25, NY-REN-25 antigen, Protein KE03 | |
Rabbit | |
Affinity Purified | |
RUO | |
88455 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction