Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ANKRD5 Antibody, Novus Biologicals™

ANKRD5 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15644420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15644420 20 μL
NBP156444 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15644420 Supplier Novus Biologicals Supplier No. NBP15644420UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Description

Rabbit Polyclonal Antibody

ANKRD5 Polyclonal specifically detects ANKRD5 in Human samples. It is validated for Western Blot.

Specifications

Antigen ANKRD5
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias ankyrin repeat domain 5, ankyrin repeat domain-containing protein 5, dJ839B4.6, FLJ21669
Gene Symbols ANKRD5
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ANKRD5 (ankyrin repeat domain 5) The peptide sequence was selected from the N terminal of ANKRD5. Peptide sequence MTIVDNEGKGVLFYCILPTKRHYRCALIALEHGADVNNSTYEGKPIFLRA.
Molecular Weight of Antigen 87 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 63926
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.