Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ANKRD5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | ANKRD5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15644420
|
Novus Biologicals
NBP15644420UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP156444
|
Novus Biologicals
NBP156444 |
100 μL |
Each for $487.50
|
|
|||||
Description
ANKRD5 Polyclonal specifically detects ANKRD5 in Human samples. It is validated for Western Blot.Specifications
| ANKRD5 | |
| Polyclonal | |
| Rabbit | |
| ankyrin repeat domain 5, ankyrin repeat domain-containing protein 5, dJ839B4.6, FLJ21669 | |
| ANKRD5 | |
| IgG | |
| 87 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 63926 | |
| Synthetic peptides corresponding to ANKRD5 (ankyrin repeat domain 5) The peptide sequence was selected from the N terminal of ANKRD5. Peptide sequence MTIVDNEGKGVLFYCILPTKRHYRCALIALEHGADVNNSTYEGKPIFLRA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title