Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ANKRD5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
| Antigen | ANKRD5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15644420
|
Novus Biologicals
NBP15644420UL |
20 μL |
Each for $204.00
|
|
|||||
|
NBP156444
|
Novus Biologicals
NBP156444 |
100 μL |
Each for $482.50
|
|
|||||
Description
ANKRD5 Polyclonal specifically detects ANKRD5 in Human samples. It is validated for Western Blot.Specifications
| ANKRD5 | |
| Polyclonal | |
| Rabbit | |
| ankyrin repeat domain 5, ankyrin repeat domain-containing protein 5, dJ839B4.6, FLJ21669 | |
| ANKRD5 | |
| IgG | |
| 87 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 63926 | |
| Synthetic peptides corresponding to ANKRD5 (ankyrin repeat domain 5) The peptide sequence was selected from the N terminal of ANKRD5. Peptide sequence MTIVDNEGKGVLFYCILPTKRHYRCALIALEHGADVNNSTYEGKPIFLRA. | |
| Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title