Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ANKS6 Antibody, Novus Biologicals™

ANKS6 Antibody, Novus Biologicals™
SDP

Catalog No. NB430933 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB430933 25 μL
NBP189081 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB430933 Supplier Novus Biologicals Supplier No. NBP18908125UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 3 publications

ANKS6 Polyclonal specifically detects ANKS6 in Human, Mouse, Rat, Zebrafish samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen ANKS6
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100 - 1:2000, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q68DC2
Gene Alias ANKRD14, ankyrin repeat and SAM domain-containing protein 6, ankyrin repeat and sterile alpha motif domain containing 6, ankyrin repeat domain 14, Ankyrin repeat domain-containing protein 14, DKFZp686D24121, DKFZp781I0117, FLJ36928, MGC70366, SAM domain-containing protein 6, SamCystin, SAMD6, sterile alpha motif domain containing 6, Sterile alpha motif domain-containing protein 6
Gene Symbols ANKS6
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TSTTSKSTSPTLTPSPSPKGHTAESSVSSSSSHRQSKSSGGSSSGTITDEDELTGILKKLSLEKYQPIFEEQEVDMEAFLTLTDGDLKELGIKTDGSRQQILAAISELNAGKGRERQILQETIHNFHSSF
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Apoptosis, Autophagy, Cancer, Cell Cycle and Replication, Cellular Markers, Chromatin Research, DNA Repair, HIF Target Genes, Hypoxia, Transcription Factors and Regulators, Wnt Signaling Pathway
Primary or Secondary Primary
Gene ID (Entrez) 203286
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Zebrafish
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.