Ankyrin repeat domain 36B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP309630100UL

Catalog No. NB124161

Description

Ankyrin repeat domain 36B Polyclonal specifically detects Ankyrin repeat domain 36B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Ankyrin repeat domain 36B
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: ankyrin repeat domain 36B, ankyrin repeat domain-containing protein 36B, CLL-associated antigen KW-1, FLJ21281, FLJ90089, KIAA1641, melanoma-associated antigen, MGC149864, MGC149865, MGC167812
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human Ankyrin repeat domain 36B (NP_079466). Peptide sequence LLDASSRHCTYLENGMQDSRKKLDQMRSQFQEIQDQLTATIRCTKEMEGD
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 57730
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.