Annexin A13 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP190157

Catalog No. NBP190157

Description

Annexin A13 Polyclonal specifically detects Annexin A13 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Annexin A13
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
• Gene Accession No.: P27216
• Gene Symbols: ANXA13
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:CTRTNKEIIAIKEAYQRLFDRSLESDVKGDTSGNLKKILVSLLQANRNEGDDVDKDLAGQDAKDLYDAGEGRWGTDEL
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 312
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: annexin A13, Annexin XIII, Annexin-13, ANX13annexin, intestine-specific, Intestine-specific annexin, ISAannexin-13, MGC150460
• Host Species: Rabbit
• Molecular Weight of Antigen: 35 kDa
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only