Annexin A4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159120

Catalog No. NBP159120

Description

Annexin A4 Polyclonal specifically detects Annexin A4 in Human, Rat, Porcine samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Annexin A4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: annexin A4, Annexin IV, annexin IV (placental anticoagulant protein II), annexin-4, ANX4Carbohydrate-binding protein p33/p41, Chromobindin-4, chromobindin-4,35-beta calcimedin, DKFZp686H02120, Endonexin I, Lipocortin IV, MGC75105, P32.5, PAP-II, PIG28, Placental anticoagulant protein II, PP4-X, proliferation-inducing gene 28, proliferation-inducing protein 28, Protein II, ZAP36
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q6LES2
• Gene Symbols: ANXA4
• Immunogen: Synthetic peptides corresponding to ANXA4 (annexin A4) The peptide sequence was selected from the N terminal of ANXA4. Peptide sequence GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ.
• Quantity: 100 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 307
• Target Species: Human, Rat, Pig, Bovine, Canine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

For Research Use Only