Invitrogen™ Annexin A4 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA578781

Catalog No. PIPA578781

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HepG2 whole cell, human A549 whole cell, human THP-1 whole cell, human Hacat whole cell, rat stomach tissue, rat lung tissue, mouse stomach tissue, mouse lung tissue. IHC: human breast cancer tissue, human colonic adenom tissue, human liver cancer tissue, human placenta tissue, mouse kidney tissue, rat kidney tissue. Flow: HEL cell.

Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells.

Specifications

• Antigen: Annexin A4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: ANXA4
• Gene Alias: 35-beta calcimedin; 36 kDa zymogen granule membrane-associated protein; AI265406; AIV; annexin 4; annexin A4; Annexin IV; annexin IV (placental anticoagulant protein II); annexin-4; ANX IV; ANX4; ANXA 4; Anxa4; ANXIV; AW106930; Carbohydrate-binding protein p33/p41; chromobindin-4; endonexin; endonexin I; epididymis secretory protein Li 274; HEL-S-274; Lipocortin IV; P32.5; p33/41 (annexin IV); PAP-II; PIG28; Placental anticoagulant protein II; PP4-X; proliferation-inducing gene 28; proliferation-inducing protein 28; Protein II; unnamed protein product; Xanx-4; ZAP 36/annexin IV; ZAP36; zymogen granule membrane associated protein
• Host Species: Rabbit
• Purification Method: Antigen Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 11746, 307, 79124
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and no preservative
• Gene Accession No.: P09525, P55260, P97429
• Gene Symbols: ANXA4
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Annexin IV (119-152aa EEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVL).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG