Annexin A8 like2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159128

Catalog No. NBP159128

Description

Annexin A8 like2 Polyclonal specifically detects Annexin A8 like2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Annexin A8 like2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: annexin A8L2, annexin A8-like 2, annexin A8-like protein 2, ANXA8, bA145E20.2, FLJ32754, FLJ54151
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q5VT79
• Gene Symbols: ANXA8L2
• Immunogen: Synthetic peptides corresponding to ANXA8L2(annexin A8-like 2) The peptide sequence was selected from the N terminal of ANXA8L2. Peptide sequence PDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTET.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 244
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.