Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Annexin A8 like2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15912820UL
Description
Annexin A8 like2 Polyclonal specifically detects Annexin A8 like2 in Human samples. It is validated for Western Blot.Specifications
Annexin A8 like2 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q5VT79 | |
ANXA8L2 | |
Synthetic peptides corresponding to ANXA8L2(annexin A8-like 2) The peptide sequence was selected from the N terminal of ANXA8L2. Peptide sequence PDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTET. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
annexin A8L2, annexin A8-like 2, annexin A8-like protein 2, ANXA8, bA145E20.2, FLJ32754, FLJ54151 | |
Rabbit | |
Affinity Purified | |
RUO | |
244 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction