Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Annexin A8 like2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | Annexin A8 like2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP1592820
|
Novus Biologicals
NBP15912820UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP159128
|
Novus Biologicals
NBP159128 |
100 μL |
Each for $487.50
|
|
|||||
Description
Annexin A8 like2 Polyclonal specifically detects Annexin A8 like2 in Human samples. It is validated for Western Blot.Specifications
| Annexin A8 like2 | |
| Polyclonal | |
| Rabbit | |
| Q5VT79 | |
| 244 | |
| Synthetic peptides corresponding to ANXA8L2(annexin A8-like 2) The peptide sequence was selected from the N terminal of ANXA8L2. Peptide sequence PDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTET. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| annexin A8L2, annexin A8-like 2, annexin A8-like protein 2, ANXA8, bA145E20.2, FLJ32754, FLJ54151 | |
| ANXA8L2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title