Invitrogen™ Annexin A8 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595411

Catalog No. PIPA595411

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human placenta tissue, human A549 whole cell. Flow: U20S cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.

Specifications

• Antigen: Annexin A8
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: ANXA8
• Gene Alias: annexin A8; Annexin VIII; annexin-8; ANX8; ANXA8; CH17-360D5.2; VAC-beta; vascular anticoagulant-beta
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 653145
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: P13928
• Gene Symbols: ANXA8
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Annexin VIII (20-61aa HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAK).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG