Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ANO6 Antibody, Novus Biologicals™

ANO6 Antibody, Novus Biologicals™
SDP

Catalog No. NBP17420420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17420420 20 μL
NBP174204 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17420420 Supplier Novus Biologicals Supplier No. NBP17420420UL

Description

Rabbit Polyclonal Antibody

ANO6 Polyclonal specifically detects ANO6 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen ANO6
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q6P9J9
Gene Alias anoctamin 6, anoctamin-6, MGC104751, Transmembrane protein 16FTMEM16FDKFZp313M0720
Gene Symbols ANO6
Host Species Rabbit
Immunogen Synthetic peptides corresponding to the middle region of Ano6. Immunizing peptide sequence SVFIVFSTTLPKNPNGTDPIQKYLTPQMATSITASIISFIIIMILNTIYE.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 196527
Target Species Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.