Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ANO6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $548.00
Specifications
| Antigen | ANO6 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17420420
|
Novus Biologicals
NBP17420420UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP174204
|
Novus Biologicals
NBP174204 |
100 μL |
Each for $548.00
|
|
|||||
Description
ANO6 Polyclonal specifically detects ANO6 in Mouse samples. It is validated for Western Blot.Specifications
| ANO6 | |
| Polyclonal | |
| Rabbit | |
| Q6P9J9 | |
| 196527 | |
| Synthetic peptides corresponding to the middle region of Ano6. Immunizing peptide sequence SVFIVFSTTLPKNPNGTDPIQKYLTPQMATSITASIISFIIIMILNTIYE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| anoctamin 6, anoctamin-6, MGC104751, Transmembrane protein 16FTMEM16FDKFZp313M0720 | |
| ANO6 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title