Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ANO6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $548.00
Specifications
Antigen | ANO6 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP17420420
![]() |
Novus Biologicals
NBP17420420UL |
20 μL |
Each for $206.00
|
|
|||||
NBP174204
![]() |
Novus Biologicals
NBP174204 |
100 μL |
Each for $548.00
|
|
|||||
Description
ANO6 Polyclonal specifically detects ANO6 in Mouse samples. It is validated for Western Blot.Specifications
ANO6 | |
Polyclonal | |
Rabbit | |
Q6P9J9 | |
196527 | |
Synthetic peptides corresponding to the middle region of Ano6. Immunizing peptide sequence SVFIVFSTTLPKNPNGTDPIQKYLTPQMATSITASIISFIIIMILNTIYE. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
anoctamin 6, anoctamin-6, MGC104751, Transmembrane protein 16FTMEM16FDKFZp313M0720 | |
ANO6 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title