Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89016001

A2M, Mouse, Clone: 2B5, Abnova™

Catalog No. 89016001 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-016-001 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-016-001 Supplier Abnova Corporation Supplier No. H00000002M03
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant A2M.

Alpha-2-macroglobulin is a protease inhibitor and cytokine transporter. It inhibits many proteases, including trypsin, thrombin and collagenase. A2M is implicated in Alzheimer disease (AD) due to its ability to mediate the clearance and degradation of A-beta, the major component of beta-amyloid deposits. [provided by RefSeq

Sequence: DCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTET

Specifications

Antigen A2M
Applications ELISA, In situ PLA, Western Blot
Classification Monoclonal
Clone 2B5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant A2M.
Formulation PBS with no preservative; pH 7.4
Gene A2M
Gene Accession No. NM_000014
Gene Alias CPAMD5/DKFZp779B086/FWP007/S863-7
Gene Symbols A2M
Host Species Mouse
Immunogen A2M (NP_000005.2, 641 a.a. ∼ 730 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.