apoptosis antagonizing transcription factor, Mouse, Clone: 3C7, Abnova™

Catalog No.	Quantity
89-001-246	100 μg

Catalog No. 89-001-246 Supplier Abnova Corporation Supplier No. H00026574M04

Description

Mouse monoclonal antibody raised against a partial recombinant AATF.

The protein encoded by this gene was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis. [provided by RefSeq

Sequence: VQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLT

Specifications

• Antigen: apoptosis antagonizing transcription factor
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 3C7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant AATF.
• Formulation: PBS with no preservative; pH 7.4
• Gene: AATF
• Gene Accession No.: BC000591
• Gene Alias: CHE-1/CHE1/DED
• Gene Symbols: AATF
• Host Species: Mouse
• Immunogen: AATF (AAH00591, 151 a.a. ∼ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Apoptosis
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 26574
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ