ATP-binding cassette, sub-family A (ABC1), member 6, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-564	50 μL

Catalog No. 89-004-564 Supplier Abnova Corporation Supplier No. H00023460A01

Description

Mouse polyclonal antibody raised against a partial recombinant ABCA6.

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This encoded protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This gene is clustered among 4 other ABC1 family members on 17q24 and may play a role in macrophage lipid homeostasis. [provided by RefSeq

Sequence: NVQFPGMAPQNLGRVDKFNSSSLMVVYTPISNLTQQIMNKTALAPLLKGTSVIGAPNKTHMDEILLENLPYAMGIIFNETFSYKLIFFQGYNSPLWK

Specifications

• Antigen: ATP-binding cassette, sub-family A (ABC1), member 6
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant ABCA6.
• Formulation: 50% glycerol
• Gene: ABCA6
• Gene Accession No.: NM_080284
• Gene Alias: EST155051/FLJ43498
• Gene Symbols: ABCA6
• Host Species: Mouse
• Immunogen: ABCA6 (NP_525023, 53 a.a. ∼ 149 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 23460
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum