ATP-binding cassette, sub-family B (MDR/TAP), member 9, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-563	50 μL

Catalog No. 89-004-563 Supplier Abnova Corporation Supplier No. H00023457A01

Description

Mouse polyclonal antibody raised against a partial recombinant ABCB9.

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. The function of this half-transporter has not yet been determined; however, this protein may play a role in lysosomes. Alternative splicing of this gene results in distinct isoforms which are likely to have different substrate specifications. [provided by RefSeq

Sequence: FIDRQPTMVHDGSLAPDHLEGRVDFENVTFTYRTRPHTQVLQNVSFSLSPGKVTALVGPSGSGKSSCVNILENFYPLEGGRVLLDGKPISAYDHKYLHR

Specifications

• Antigen: ATP-binding cassette, sub-family B (MDR/TAP), member 9
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant ABCB9.
• Formulation: 50% glycerol
• Gene: ABCB9
• Gene Accession No.: NM_019625
• Gene Alias: EST122234/KIAA1520/TAPL
• Gene Symbols: ABCB9
• Host Species: Mouse
• Immunogen: ABCB9 (NP_062571, 482 a.a. ∼ 580 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 23457
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum