Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ABCC2, Mouse, Clone: 1C5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ABCC2.

Manufacturer:  Abnova Corporation H00001244M01

Catalog No. 89-021-123


  Check Availability
Add to cart

Specifications

Description

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is expressed in the canalicular (apical) part of the hepatocyte and functions in biliary transport. Substrates include anticancer drugs such as vinblastine; therefore, this protein appears to contribute to drug resistance in mammalian cells. Several different mutations in this gene have been observed in patients with Dubin-Johnson syndrome (DJS), an autosomal recessive disorder characterized by conjugated hyperbilirubinemia. [provided by RefSeq

Sequence: LKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKRELQKARRALQRRQEKSSQQNSGARLPGLNKNQSQSQDALVLEDVEKKKKKSGTKKDVPKSWLMKA
Description & Specifications

Specifications

ABCC2
1C5
ATP-binding cassette, subfamily C (CFTR/MRP), member 2
ABCC2
Liquid
ABCC2
ABCC2 (NP_000383, 214 a.a. ∽314 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa.
50μg
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA,Sandwich ELISA,Western Blot
Unlabeled
In 1X PBS, pH 7.4
NM_000392
ABC30, CMOAT, DJS, KIAA1010, MRP2, cMRP
Murine
IgG1, κ
RUO
Primary
1244
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit