abhydrolase domain containing 5, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-620	50 μL

Catalog No. 89-004-620 Supplier Abnova Corporation Supplier No. H00051099A02

Description

Mouse polyclonal antibody raised against a partial recombinant ABHD5.

The protein encoded by this gene belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in this gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation. [provided by RefSeq

Sequence: FEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQRIGKMHPDIPVSVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQKVK

Specifications

• Antigen: abhydrolase domain containing 5
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant ABHD5.
• Formulation: 50% glycerol
• Gene: ABHD5
• Gene Accession No.: NM_016006
• Gene Alias: CDS/CGI58/IECN2/MGC8731/NCIE2
• Gene Symbols: ABHD5
• Host Species: Mouse
• Immunogen: ABHD5 (NP_057090, 240 a.a. ∼ 342 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 51099
• Target Species: Human, Mouse, Rat
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum