v-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene), Mouse, Clone: 5C6, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ABL2.

Supplier:  Abnova Corporation H00000027M09

Catalog No. 89-000-501

Description

This gene encodes a member of the Abelson family of nonreceptor tyrosine protein kinase. The protein is highly similar to the ABL1 protein, including the tyrosine kinase, SH2 and SH3 domains, and has a role in cytoskeletal rearrangements by its C-terminal F-actin- and microtubule-binding sequences. This gene is expressed in both normal and tumor cells, and is involved in translocation with the ETV6 gene in leukemia. Multiple alternatively spliced transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq

Sequence: KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA

Specifications

• Antigen: v-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC065912
• Gene Symbols: ABL2
• Immunogen: ABL2 (AAH65912, 743 a.a. ∼ 842 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Kinases
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 5C6
• Description: Mouse monoclonal antibody raised against a partial recombinant ABL2.
• Gene: ABL2
• Gene Alias: ABLL/ARG/FLJ22224/FLJ31718/FLJ41441
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 27
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG3 κ