ABL2, Mouse, Clone: 6D5, Abnova™

Catalog No.	Quantity
89-016-009	100 μg

Catalog No. 89-016-009 Supplier Abnova Corporation Supplier No. H00000027M03

Description

Mouse monoclonal antibody raised against a partial recombinant ABL2.

This gene encodes a member of the Abelson family of nonreceptor tyrosine protein kinase. The protein is highly similar to the ABL1 protein, including the tyrosine kinase, SH2 and SH3 domains, and has a role in cytoskeletal rearrangements by its C-terminal F-actin- and microtubule-binding sequences. This gene is expressed in both normal and tumor cells, and is involved in translocation with the ETV6 gene in leukemia. Multiple alternatively spliced transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq

Sequence: KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA

Specifications

• Antigen: ABL2
• Applications: ELISA, In situ PLA, KnockDown, Western Blot
• Classification: Monoclonal
• Clone: 6D5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ABL2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ABL2
• Gene Accession No.: BC065912
• Gene Alias: ABLL/ARG/FLJ22224/FLJ31718/FLJ41441
• Gene Symbols: ABL2
• Host Species: Mouse
• Immunogen: ABL2 (AAH65912, 743 a.a. ∼ 842 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 27
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ