Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89123218

ABLIM1, Mouse, Clone: 2C6, Abnova™

Catalog No. 89123218 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-123-218 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-123-218 Supplier Abnova Corporation Supplier No. H00003983M06
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant ABLIM1.

This gene encodes a cytoskeletal LIM protein that binds to actin filaments via a domain that is homologous to erythrocyte dematin. LIM domains, found in over 60 proteins, play key roles in the regulation of developmental pathways. LIM domains also function as protein-binding interfaces, mediating specific protein-protein interactions. The protein encoded by this gene could mediate such interactions between actin filaments and cytoplasmic targets. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq

Sequence: RYDSPINSASHIPSSKTASLPGYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMRMDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILREVD

Specifications

Antigen ABLIM1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2C6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant ABLIM1.
Formulation PBS with no preservative; pH 7.4
Gene ABLIM1
Gene Accession No. NM_002313
Gene Alias ABLIM/DKFZp781D0148/FLJ14564/KIAA0059/LIMAB1/LIMATIN/MGC1224
Gene Symbols ABLIM1
Host Species Mouse
Immunogen ABLIM1 (NP_002304, 637 a.a. ∼ 736 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3983
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.