actin binding LIM protein 1, Mouse, Clone: 3A1, Abnova™

Catalog No.	Quantity
89-001-468	200 μL

Catalog No. 89-001-468 Supplier Abnova Corporation Supplier No. H00003983M01A

Description

Mouse monoclonal antibody raised against a partial recombinant ABLIM1.

This gene encodes a cytoskeletal LIM protein that binds to actin filaments via a domain that is homologous to erythrocyte dematin. LIM domains, found in over 60 proteins, play key roles in the regulation of developmental pathways. LIM domains also function as protein-binding interfaces, mediating specific protein-protein interactions. The protein encoded by this gene could mediate such interactions between actin filaments and cytoplasmic targets. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq

Sequence: RYDSPINSASHIPSSKTASLPGYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMRMDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILREVD

Specifications

• Antigen: actin binding LIM protein 1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3A1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ABLIM1.
• Formulation: ascites with no preservative
• Gene: ABLIM1
• Gene Accession No.: NM_002313
• Gene Alias: ABLIM/DKFZp781D0148/FLJ14564/KIAA0059/LIMAB1/LIMATIN/MGC1224
• Gene Symbols: ABLIM1
• Host Species: Mouse
• Immunogen: ABLIM1 (NP_002304, 637 a.a. ∼ 736 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 3983
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2a κ