ABP1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant ABP1.

Supplier:  Abnova Corporation H00000026A01

Catalog No. 89-003-212

Description

This gene encodes a membrane glycoprotein that is expressed in many epithelium-rich and/or hematopoietic tissues and oxidatively deaminates putrescine and histamine. The protein may play a role in controlling the level of histamine and/or putrescine in these tissues. It also binds to and is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels. [provided by RefSeq

Sequence: LHTHLIGNIHTHLVHYRVDLDVAGTKNSFQTLQMKLENITNPWSPRHRVVQPTLEQTQYSWERQAAFRFKRKLPKYLLFTSPQENPWGHKRSYRLQIHS

Specifications

• Antigen: ABP1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant ABP1.
• Gene: ABP1
• Gene Alias: ABP/AOC1/DAO/DAO1/KAO
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_001091
• Gene Symbols: ABP1
• Immunogen: ABP1 (NP_001082, 501 a.a. ∼ 599 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 26
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.