Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

acetyl-Coenzyme A acyltransferase 2, Mouse, Clone: 5C4, Abnova™

Catalog No. 89014262 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-262 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-262 Supplier Abnova Corporation Supplier No. H00010449M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant ACAA2.

The encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a noncleavable amino-terminal targeting signal. [provided by RefSeq

Sequence: SLTDQHVQLPMAMTAENLTVKHKISREECDKYALQSQQRWKAANDAGYFNDEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKDGTVTAGNASGVADGAGAV

Specifications

Antigen acetyl-Coenzyme A acyltransferase 2
Applications ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Classification Monoclonal
Clone 5C4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant ACAA2.
Formulation PBS with no preservative; pH 7.4
Gene ACAA2
Gene Accession No. NM_006111
Gene Alias DSAEC/FLJ35992/FLJ95265
Gene Symbols ACAA2
Host Species Mouse
Immunogen ACAA2 (NP_006102, 151 a.a. ∼ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10449
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.