ACADVL, Mouse, Clone: 5D3, Abnova™

Catalog No.	Quantity
89-016-018	100 μg

Catalog No. 89-016-018 Supplier Abnova Corporation Supplier No. H00000037M01

Description

Mouse monoclonal antibody raised against a partial recombinant ACADVL.

The protein encoded by this gene is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq

Sequence: AAALAGTMRGIIAKAVDHATNRTQFGEKIHNFGLIQEKLARMVMLQYVTESMAYMVSANMDQGATDFQIEAAISKIFGSEAAWKVTDECI

Specifications

• Antigen: ACADVL
• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 5D3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ACADVL.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ACADVL
• Gene Accession No.: NM_000018
• Gene Alias: ACAD6/LCACD/VLCAD
• Gene Symbols: ACADVL
• Host Species: Mouse
• Immunogen: ACADVL (NP_000009, 345 a.a. ∼ 434 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 37
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ