Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ACBP Rabbit anti-Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154806

Catalog No. NBP154806


Add to cart

Description

Description

ACBP Polyclonal antibody specifically detects ACBP in Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).
Specifications

Specifications

ACBP
Unconjugated
PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
DBI
Synthetic peptides corresponding to DBI(diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein)) The peptide sequence was selected from the N terminal of DBI. Peptide sequence MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYK
10 kDa
100 ul
Cancer
Primary
1622
Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit, Rat
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 0.2-1 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 5 ug/ml
P07108
acyl-Coenzyme A binding domain containing 1, acyl-Coenzyme A bindingprotein), CCK-RP, cholecystokinin-releasing peptide, trypsin-sensitive, diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein), Diazepam-binding inhibitor, endozepine, EP, GABA receptor modulator, MGC70414
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only