ACE, Mouse, Clone: 6A4, Abnova™

Catalog No.	Quantity
89-021-272	100 μg

Catalog No. 89-021-272 Supplier Abnova Corporation Supplier No. H00001636M01

Description

Mouse monoclonal antibody raised against a partial recombinant ACE.

This gene encodes an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This enzyme plays a key role in the renin-angiotensin system. Many studies have associated the presence or absence of a 287bp Alu repeat element in this gene with the levels of circulating enzyme or cardiovascular pathophysiologies. Two most abundant alternatively spliced variants of this gene encode two isozymes - the somatic form and the testicular form that are equally active. Multiple additional alternatively spliced variants have been identified but their full length nature has not been determined. [provided by RefSeq

Sequence: RLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPNSDDFYNETETKIFLQFYDQTGIWDHGAPHLLPPSQARGTREAPVYM

Specifications

• Antigen: ACE
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 6A4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ACE.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ACE
• Gene Accession No.: BC036375
• Gene Alias: ACE1/CD143/DCP/DCP1/MGC26566
• Gene Symbols: ACE
• Host Species: Mouse
• Immunogen: ACE (AAH36375, 592 a.a. ∼ 701 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1636
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ