Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Acetyl-coenzyme A transporter 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP190811
Description
Acetyl-coenzyme A transporter 1 Polyclonal specifically detects Acetyl-coenzyme A transporter 1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Acetyl-coenzyme A transporter 1 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
O00400 | |
SLC33A1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:IMAFNAKVSDPLIGGTYMTLLNTVSNLGGNWPSTVALWLVDPLTVKECVGASNQNCRTPDAVELCKKLGGSCVT | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
ACATNAcetyl-CoA transporter 1, acetyl-Coenzyme A transporter, AT-1acetyl-coenzyme A transporter 1, AT1SPG42, solute carrier family 33 (acetyl-CoA transporter), member 1, Solute carrier family 33 member 1, spastic paraplegia 42 (autosomal dominant) | |
Rabbit | |
Affinity Purified | |
RUO | |
9197 | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction