ACPP, Mouse, Clone: 2D11, Abnova™

Catalog No.	Quantity
89-016-031	100 μg

Catalog No. 89-016-031 Supplier Abnova Corporation Supplier No. H00000055M01

Description

Mouse monoclonal antibody raised against a partial recombinant ACPP.

This gene encodes an enzyme that catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is synthesized under androgen regulation and is secreted by the epithelial cells of the prostate gland. An alternatively spliced transcript variant encoding a longer isoform has been found for this gene. This isoform contains a transmembrane domain and is localized in the plasma membrane-endosomal-lysosomal pathway. [provided by RefSeq

Sequence: YASCHLTELYFEKGEYFVEMYYRNETQHEPYPLMLPGCSPSCPLERFAELAGPVIPQDWSTECMTTNSHQVLKVIFAVAFCLISAVLMVLLFIHIRRGLCWQRESYGNI

Specifications

• Antigen: ACPP
• Applications: ELISA
• Classification: Monoclonal
• Clone: 2D11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ACPP.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ACPP
• Gene Accession No.: BC007460
• Gene Alias: ACP-3/ACP3/PAP
• Gene Symbols: ACPP
• Host Species: Mouse
• Immunogen: ACPP (AAH07460, 310 a.a. ∼ 418 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 55
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ