acyl-CoA synthetase long-chain family member 1, Mouse, Clone: 3G4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ACSL1.

Supplier:  Abnova Corporation H00002180M02

Catalog No. 89-014-108

Description

The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. [provided by RefSeq

Sequence: PKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTA

Specifications

• Antigen: acyl-CoA synthetase long-chain family member 1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_001995
• Gene Symbols: ACSL1
• Immunogen: ACSL1 (NP_001986, 48 a.a. ∼ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Endocrine/Metabolism
• Gene ID (Entrez): 2180
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Western Blot
• Clone: 3G4
• Description: Mouse monoclonal antibody raised against a partial recombinant ACSL1.
• Gene: ACSL1
• Gene Alias: ACS1/FACL1/FACL2/LACS/LACS1/LACS2
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody