acyl-CoA synthetase long-chain family member 3, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant ACSL3.

Supplier:  Abnova Corporation H00002181A01

Catalog No. 89-004-121

Description

The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates. The amino acid sequence of this isozyme is 92% identical to that of rat homolog. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq

Sequence: NETEVTNIITSKELLQTKLKDIVSLVPRLRHIITVDGKPPTWSEFPKGIIVHTMAAVEALGAKASMENQPHSKPLPSDIAVIMYTS

Specifications

• Antigen: acyl-CoA synthetase long-chain family member 3
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant ACSL3.
• Gene: ACSL3
• Gene Alias: ACS3/FACL3/PRO2194
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Endocrine/Metabolism
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_004457
• Gene Symbols: ACSL3
• Immunogen: ACSL3 (NP_004448, 203 a.a. ∼ 288 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 2181
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.