actinin, alpha 1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-004	50 μL

Catalog No. 89-004-004 Supplier Abnova Corporation Supplier No. H00000087A01

Description

Mouse polyclonal antibody raised against a partial recombinant ACTN1.

Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a nonmuscle, cytoskeletal, alpha actinin isoform and maps to the same site as the structurally similar erythroid beta spectrin gene. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: EIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQA

Specifications

• Antigen: actinin, alpha 1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant ACTN1.
• Formulation: 50% glycerol
• Gene: ACTN1
• Gene Accession No.: NM_001102
• Gene Alias: FLJ40884
• Gene Symbols: ACTN1
• Host Species: Mouse
• Immunogen: ACTN1 (NP_001093, 543 a.a. ∼ 639 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 87
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum