ACVR1B, Mouse, Clone: 6G11, Abnova™

Catalog No.	Quantity
89-016-041	100 μg

Catalog No. 89-016-041 Supplier Abnova Corporation Supplier No. H00000091M08

Description

Mouse monoclonal antibody raised against a partial recombinant ACVR1B.

Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with a cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling, and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. This gene encodes activin A type IB receptor, composed of 11 exons. Alternative splicing and alternative polyadenylation result in 3 fully described transcript variants. The mRNA expression of variants 1, 2, and 3 is confirmed, and a potential fourth variant contains an alternative exon 8 and lacks exons 9 through 11, but its mRNA expression has not been confirmed. [provided by RefSeq

Sequence: SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE

Specifications

• Antigen: ACVR1B
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 6G11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ACVR1B.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ACVR1B
• Gene Accession No.: BC000254
• Gene Alias: ACTRIB/ACVRLK4/ALK4/SKR2
• Gene Symbols: ACVR1B
• Host Species: Mouse
• Immunogen: ACVR1B (AAH00254, 24 a.a. ∼ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 91
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ