activin A receptor type II-like 1, Mouse, Clone: 7H2, Abnova™

Catalog No.	Quantity
89-000-505	100 μg

Catalog No. 89-000-505 Supplier Abnova Corporation Supplier No. H00000094M02

Description

Mouse monoclonal antibody raised against a partial recombinant ACVRL1.

This gene encodes a type I cell-surface receptor for the TGF-beta superfamily of ligands. It shares with other type I receptors a high degree of similarity in serine-threonine kinase subdomains, a glycine- and serine-rich region (called the GS domain) preceding the kinase domain, and a short C-terminal tail. The encoded protein, sometimes termed ALK1, shares similar domain structures with other closely related ALK or activin receptor-like kinase proteins that form a subfamily of receptor serine/threonine kinases. Mutations in this gene are associated with hemorrhagic telangiectasia type 2, also known as Rendu-Osler-Weber syndrome 2. [provided by RefSeq

Sequence: DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQL

Specifications

• Antigen: activin A receptor type II-like 1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 7H2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ACVRL1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ACVRL1
• Gene Accession No.: BC042637
• Gene Alias: ACVRLK1/ALK-1/ALK1/HHT/HHT2/ORW2/SKR3/TSR-I
• Gene Symbols: ACVRL1
• Host Species: Mouse
• Immunogen: ACVRL1 (AAH42637, 22 a.a. ∼ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Kinases
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 94
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ