ACYP1, Mouse, Clone: 1B2-3A2, Abnova™

Catalog No.	Quantity
89-016-047	100 μg

Catalog No. 89-016-047 Supplier Abnova Corporation Supplier No. H00000097M01

Description

Mouse monoclonal antibody raised against a full-length recombinant ACYP1.

Acylphosphatase is a small cytosolic enzyme that catalyzes the hydrolysis of the carboxyl-phosphate bond of acylphosphates. Two isoenzymes have been isolated, called muscle acylphosphatase and erythrocyte acylphosphatase, on the basis of their tissue localization. This gene encodes the erythrocyte acylphosphatase isoenzyme. Alternatively spliced transcript variants that encode different proteins were identified through data analysis. [provided by RefSeq

Sequence: MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK

Specifications

• Antigen: ACYP1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: S3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant ACYP1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ACYP1
• Gene Accession No.: BC035568
• Gene Alias: ACYPE
• Gene Symbols: ACYP1
• Host Species: Mouse
• Immunogen: ACYP1 (AAH35568, 1 a.a. ∼ 99 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 97
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ