ADAM metallopeptidase domain 30, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-531	50 μL

Catalog No. 89-004-531 Supplier Abnova Corporation Supplier No. H00011085A01

Description

Mouse polyclonal antibody raised against a partial recombinant ADAM30.

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This gene is testis-specific and contains a polymorphic region, resulting in isoforms with varying numbers of C-terminal repeats. [provided by RefSeq

Sequence: YKHPKYLELILLFDQSRYRFVNNNLSQVIHDAILLTGIMDTYFQDVRMRIHLKALEVWTDFNKIRVGYPELAEVLGRFVIYKKSVLNARLSSDWAHLYLQ

Specifications

• Antigen: ADAM metallopeptidase domain 30
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant ADAM30.
• Formulation: 50% glycerol
• Gene: ADAM30
• Gene Accession No.: NM_021794
• Gene Alias: svph4
• Gene Symbols: ADAM30
• Host Species: Mouse
• Immunogen: ADAM30 (NP_068566, 199 a.a. ∼ 298 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 11085
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum