ADAM7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169366

Catalog No. NBP169366

Description

ADAM7 Polyclonal specifically detects ADAM7 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ADAM7
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: a disintegrin and metalloproteinase domain 7, ADAM 7, ADAM metallopeptidase domain 7, disintegrin and metalloproteinase domain-containing protein 7, EAPI, epididymal apical protein I, GP83, GP-83, Sperm maturation-related glycoprotein GP-83
• Host Species: Rabbit
• Molecular Weight of Antigen: 83 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Canine: 86%; Equine: 85%.
• Target Species: Human, Mouse, Canine, Equine
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9H2U9
• Gene Symbols: ADAM7
• Immunogen: Synthetic peptides corresponding to ADAM7(ADAM metallopeptidase domain 7) The peptide sequence was selected from the C terminal of ADAM7. Peptide sequence PTETLGVENKGYFGDEQQIRTEPILPEIHFLNKPASKDSRGIADPNQSAK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8756
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only